ERGI3 Antibody - #AF0676
Product: | ERGI3 Antibody |
Catalog: | AF0676 |
Description: | Rabbit polyclonal antibody to ERGI3 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 43kDa; 43kD(Calculated). |
Uniprot: | Q9Y282 |
RRID: | AB_2834351 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF0676, RRID:AB_2834351.
Fold/Unfold
2310015B14Rik; AV318804; C20orf47; CGI 54; D2Ucla1; dJ477O4.2; DKFZp547A2190; Endoplasmic reticulum Golgi intermediate compartment protein 3; endoplasmic reticulum localized protein ERp43; Endoplasmic reticulum-Golgi intermediate compartment protein 3; ERGI3_HUMAN; ERGIC and golgi 3; ergic3; ERV46; NY BR 84; PRO0989; RP23-220D12.2; RP3-477O4.1; SDBCAG84; Serologically defined breast cancer antigen 84; Serologically defined breast cancer antigen NY BR 84; Serologically defined breast cancer antigen NY-BR-84;
Immunogens
- Q9Y282 ERGI3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEALGKLKQFDAYPKTLEDFRVKTCGGATVTIVSGLLMLLLFLSELQYYLTTEVHPELYVDKSRGDKLKINIDVLFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGIPVSSEAERHELGKVEVTVFDPDSLDPDRCESCYGAEAEDIKCCNTCEDVREAYRRRGWAFKNPDTIEQCRREGFSQKMQEQKNEGCQVYGFLEVNKVAGNFHFAPGKSFQQSHVHVHDLQSFGLDNINMTHYIQHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGMFTVAGLIDSLIYHSARAIQKKIDLGKTT
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9Y282 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
M1 | Acetylation | Uniprot | |
K6 | Ubiquitination | Uniprot | |
K8 | Ubiquitination | Uniprot | |
K15 | Ubiquitination | Uniprot | |
Y83 | Phosphorylation | Uniprot | |
K110 | Ubiquitination | Uniprot | |
S116 | Phosphorylation | Uniprot | |
S117 | Phosphorylation | Uniprot | |
K126 | Ubiquitination | Uniprot | |
S136 | Phosphorylation | Uniprot | |
K174 | Ubiquitination | Uniprot | |
K190 | Sumoylation | Uniprot | |
K190 | Ubiquitination | Uniprot | |
K195 | Ubiquitination | Uniprot | |
Y202 | Phosphorylation | Uniprot | |
K209 | Ubiquitination | Uniprot | |
N241 | N-Glycosylation | Uniprot | |
K289 | Ubiquitination | Uniprot | |
K381 | Ubiquitination | Uniprot |
Research Backgrounds
Possible role in transport between endoplasmic reticulum and Golgi.
Endoplasmic reticulum-Golgi intermediate compartment membrane>Multi-pass membrane protein. Golgi apparatus>cis-Golgi network membrane>Multi-pass membrane protein. Endoplasmic reticulum membrane>Multi-pass membrane protein.
Note: Cycles between the endoplasmic reticulum and the Golgi.
Interacts with ERGIC1/ERGIC32.
Belongs to the ERGIC family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.