ARMX3 Antibody - #AF0514
Product: | ARMX3 Antibody |
Catalog: | AF0514 |
Description: | Rabbit polyclonal antibody to ARMX3 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
Mol.Wt.: | 38kDa; 43kD(Calculated). |
Uniprot: | Q9UH62 |
RRID: | AB_2834343 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF0514, RRID:AB_2834343.
Fold/Unfold
1200004E24Rik; ALEX3; ARM protein lost in epithelial cancers on chromosome X 3; Arm protein lost in epithelial cancers, X chromosome, 3; Armadillo repeat containing X linked protein 3; dJ545K15.2; DKFZp781N1954; KIAA0443; MGC12199;
Immunogens
- Q9UH62 ARMX3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGYARKVGWVTAGLVIGAGACYCIYRLTRGRKQNKEKMAEGGSGDVDDAGDCSGARYNDWSDDDDDSNESKSIVWYPPWARIGTEAGTRARARARARATRARRAVQKRASPNSDDTVLSPQELQKVLCLVEMSEKPYILEAALIALGNNAAYAFNRDIIRDLGGLPIVAKILNTRDPIVKEKALIVLNNLSVNAENQRRLKVYMNQVCDDTITSRLNSSVQLAGLRLLTNMTVTNEYQHMLANSISDFFRLFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKENKEVILKLLVIFENINDNFKWEENEPTQNQFGEGSLFFFLKEFQVCADKVLGIESHHDFLVKVKVGKFMAKLAEHMFPKSQE
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9UH62 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S43 | Phosphorylation | Uniprot | |
C52 | S-Nitrosylation | Uniprot | |
S53 | Phosphorylation | Uniprot | |
Y57 | Phosphorylation | Uniprot | |
S61 | Phosphorylation | Uniprot | |
S67 | Phosphorylation | Uniprot | |
S72 | Phosphorylation | Uniprot | |
S110 | Phosphorylation | Uniprot | |
S113 | Phosphorylation | Uniprot | |
T116 | Phosphorylation | Uniprot | |
S119 | Phosphorylation | Uniprot | |
K170 | Ubiquitination | Uniprot | |
K182 | Ubiquitination | Uniprot | |
Y237 | Phosphorylation | Uniprot | |
K260 | Ubiquitination | Uniprot | |
K317 | Sumoylation | Uniprot |
Research Backgrounds
Regulates mitochondrial aggregation and transport in axons in living neurons. May link mitochondria to the TRAK2-kinesin motor complex via its interaction with Miro and TRAK2. Mitochondrial distribution and dynamics is regulated through ARMCX3 protein degradation, which is promoted by PCK and negatively regulated by WNT1. Enhances the SOX10-mediated transactivation of the neuronal acetylcholine receptor subunit alpha-3 and beta-4 subunit gene promoters.
Mitochondrion outer membrane>Single-pass membrane protein. Cytoplasm. Nucleus.
Interacts (via ARM domain) with MIRO1, MIRO2 and TRAK2. The interaction with Miro is calcium-dependent. Interacts with SOX10.
Belongs to the eutherian X-chromosome-specific Armcx family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.