Price Size
$280 100ul
$350 200ul

Same day delivery


For pricing and ordering contact:

local distributors
  • Product Name
    Phospho-YAP (Ser127) Antibody
  • Catalog No.
    AF3328
  • RRID
    AB_2810276
  • Source
    Rabbit
  • Application
    WB,IHC,IF/ICC,ELISA(peptide)
  • Reactivity
    Human, Mouse, Rat, Monkey
  • Prediction
    Pig, Zebrafish, Horse, Sheep, Rabbit, Chicken, Xenopus
  • UniProt
  • Mol.Wt
    65~78kD;
    54kDa(Calculated).
  • Concentration
    1mg/ml
  • Browse similar products>>

Related Products

Product Information

Alternative Names:Expand▼

65 kDa Yes associated protein; 65 kDa Yes-associated protein; COB1; YAp 1; YAP 65; YAP; YAP1; YAP1_HUMAN; YAP2; YAP65; yes -associated protein delta; Yes associated protein 1 65kDa; Yes associated protein 1; Yes associated protein 2; yes associated protein beta; YKI; Yorkie homolog;

Applications:

WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.

Reactivity:

Human, Mouse, Rat, Monkey

Predicted Reactivity:

Pig, Zebrafish, Horse, Sheep, Rabbit, Chicken, Xenopus

Source:

Rabbit

Clonality:

Polyclonal

Purification:

The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.

Specificity:

Phospho-YAP (Ser127) Antibody detects endogenous levels of YAP only when phosphorylated at Serine 127.

RRID:

AB_2810276
Please cite this product as: Affinity Biosciences Cat# AF3328, RRID:AB_2810276.

Format:

Liquid

Concentration:

1mg/ml

Storage Condition and Buffer:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.Store at -20 °C.Stable for 12 months from date of receipt.

Immunogen Information in 3D

Immunogen:

A synthesized peptide derived from human YAP around the phosphorylation site of Ser127.

Uniprot:



>>Visit The Human Protein Atlas

Gene ID:

Gene Name:

YAP1

Molecular Weight:

Observed Mol.Wt.: 65~78kD.
Predicted Mol.Wt.: 54kDa(Calculated)..

Subcellular Location:

Cytoplasm. Nucleus. Both phosphorylation and cell density can regulate its subcellular localization. Phosphorylation sequesters it in the cytoplasm by inhibiting its translocation into the nucleus. At low density, predominantly nuclear and is translocated to the cytoplasm at high density.

Tissue Specificity:

P46937 YAP1_HUMAN:
Increased expression seen in some liver and prostate cancers. Isoforms lacking the transactivation domain found in striatal neurons of patients with Huntington disease (at protein level).

Description:

This gene encodes the human ortholog of chicken YAP protein which binds to the SH3 domain of the Yes proto-oncogene product. This protein contains a WW domain that is found in various structural, regulatory and signaling molecules in yeast, nematode, and mammals, and may be involved in protein-protein interaction.

Sequence:
MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL

Research Background

Function:

Transcriptional regulator which can act both as a coactivator and a corepressor and is the critical downstream regulatory target in the Hippo signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Plays a key role in tissue tension and 3D tissue shape by regulating cortical actomyosin network formation. Acts via ARHGAP18, a Rho GTPase activating protein that suppresses F-actin polymerization. Plays a key role to control cell proliferation in response to cell contact. Phosphorylation of YAP1 by LATS1/2 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. The presence of TEAD transcription factors are required for it to stimulate gene expression, cell growth, anchorage-independent growth, and epithelial mesenchymal transition (EMT) induction.

Isoform 2 and isoform 3 can activate the C-terminal fragment (CTF) of ERBB4 (isoform 3).

Post-translational Modifications:

Phosphorylated by LATS1 and LATS2; leading to cytoplasmic translocation and inactivation. Phosphorylated by ABL1; leading to YAP1 stabilization, enhanced interaction with TP73 and recruitment onto proapoptotic genes; in response to DNA damage. Phosphorylation at Ser-400 and Ser-403 by CK1 is triggered by previous phosphorylation at Ser-397 by LATS proteins and leads to YAP1 ubiquitination by SCF(beta-TRCP) E3 ubiquitin ligase and subsequent degradation. Phosphorylated at Thr-119, Ser-138, Thr-154, Ser-367 and Thr-412 by MAPK8/JNK1 and MAPK9/JNK2, which is required for the regulation of apoptosis by YAP1.

Ubiquitinated by SCF(beta-TRCP) E3 ubiquitin ligase.

Subcellular Location:

Cytoplasm. Nucleus.
Note: Both phosphorylation and cell density can regulate its subcellular localization. Phosphorylation sequesters it in the cytoplasm by inhibiting its translocation into the nucleus. At low density, predominantly nuclear and is translocated to the cytoplasm at high density (PubMed:18158288, PubMed:20048001). PTPN14 induces translocation from the nucleus to the cytoplasm (PubMed:22525271).

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte

Tissue Specificity:

Increased expression seen in some liver and prostate cancers. Isoforms lacking the transactivation domain found in striatal neurons of patients with Huntington disease (at protein level).

Subunit Structure:

Binds to the SH3 domain of the YES kinase. Binds to WBP1 and WBP2. Binds, in vitro, through the WW1 domain, to neural isoforms of ENAH that contain the PPSY motif (By similarity). The phosphorylated form interacts with YWHAB. Interacts (via WW domains) with LATS1 (via PPxY motif 2). Interacts with LATS2. Isoform 2 and isoform 3 interact (via WW domain 1) with isoform 3 of ERBB4 (via PPxY motif 2). Interacts with TEAD1, TEAD2, TEAD3 and TEAD4. Interacts with TP73. Interacts with RUNX1. Interacts with HCK. Interacts (via WW domains) with PTPN14 (via PPxY motif 2); this interaction leads to the cytoplasmic sequestration of YAP1 and inhibits its transcriptional coactivator activity.

Similarity:

The first coiled-coil region mediates most of the interaction with TEAD transcription factors.

Belongs to the YAP1 family.

Research Fields

Research Fields:

· Environmental Information Processing > Signal transduction > Hippo signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > Hippo signaling pathway - multiple species.(View pathway)

Reference Citations:

1). Zhou B et al. Interaction between laminin-5γ2 and integrin β1 promotes the tumor budding of colorectal cancer via the activation of Yes-associated proteins. Oncogene 2019 Nov 1 (PubMed: 31676872) [IF=7.971]

2). Yang Y;Pei K;Zhang Q;Wang D;Feng H;Du Z;Zhang C;Gao Z;Yang W;Wu J;Li Y; et al. Salvianolic acid B ameliorates atherosclerosis via inhibiting YAP/TAZ/JNK signaling pathway in endothelial cells and pericytes. Biochim Biophys Acta Mol Cell Biol Lipids 2020 Jul 30;158779. (PubMed: 32739616) [IF=4.519]

3). Xu G;Chen J;Wang G;Xiao J;Zhang N;Chen Y;Yu H;Wang G;Zhao Y; et al. Resveratrol Inhibits the Tumorigenesis of Follicular Thyroid Cancer via ST6GAL2-Regulated Activation of the Hippo Signaling Pathway. Mol Ther Oncolytics 2020 Jan 10;16:124-133. (PubMed: 32055676) [IF=4.115]

4). Wang X;Zhang H;Ge Y;Cao L;He Y;Sun G;Jia S;Ma A;Liu J;Rong D;Guo W; et al. AT1R regulates macrophage polarization through YAP and regulates aortic dissection incidence. Front Physiol 2021 Jul 9;12:644903. (PubMed: 34305627) [IF=3.367]

5). Wang H;Xu P;Luo X;Hu M;Liu Y;Yang Y;Peng W;Bai Y;Chen X;Tan B;Wu Y;Wen L;Gao R;Tong C;Qi H;Kilby MD;Saffery R;Baker PN; et al. Phosphorylation of YAP Impairs Trophoblast Invasion and Migration: Implications for the Pathogenesis of Fetal Growth Restriction. Biol Reprod 2020 Jun 24;ioaa112. (PubMed: 32582940) [IF=3.322]

6). Wang X et al. Angiotensin type 1 receptor regulates yes-associated protein in vascular endothelial cells. Exp Ther Med 2020 Jan;19 (PubMed: 31885711)

No comment
Total 0 records, divided into1 pages. First Prev Next Last

Submit Review

Support JPG, GIF, PNG format only
captcha
Catalog Number :

AF3328-BP
(Blocking peptide available as AF3328-BP)

Price/Size :

$350/1mg.
Tips: For phospho antibody, we provide phospho peptide(0.5mg) and non-phospho peptide(0.5mg).

Function :

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. This mechanism is useful when non-specific binding is an issue, for example, in Western blotting (immunoblot) and immunohistochemistry (IHC). By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific; Specific binding will be absent from the western blot or immunostaining performed with the neutralized antibody.

Format and storage :

Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 10 mg/ml.The purity is >90%,tested by HPLC and MS.Storage Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.

Precautions :

This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Pig
100%
Horse
100%
Sheep
100%
Xenopus
100%
Zebrafish
100%
Chicken
100%
Rabbit
100%
Bovine
0%
Dog
0%
High similarity Medium similarity Low similarity No similarity
P46937 as Substrate
Site PTM Type Enzyme
S61 Phosphorylation Q15208 (STK38) , Q13131 (PRKAA1)
T63 Phosphorylation
T77 Phosphorylation
T83 Phosphorylation
K90 Ubiquitination
S94 Phosphorylation Q13131 (PRKAA1)
K97 Acetylation
K97 Sumoylation
K97 Ubiquitination
K102 Ubiquitination
S103 Phosphorylation
S105 Phosphorylation
S109 Phosphorylation Q05513 (PRKCZ) , Q15208 (STK38)
T110 Phosphorylation Q05513 (PRKCZ)
T114 Phosphorylation
T119 Phosphorylation P06493 (CDK1) , P45984 (MAPK9)
S127 Phosphorylation Q15208 (STK38) , P31749 (AKT1) , Q9NRM7 (LATS2) , Q13188 (STK3) , Q9Y2H1 (STK38L) , O95835 (LATS1)
S128 Phosphorylation Q9UBE8 (NLK)
S131 Phosphorylation
S138 Phosphorylation P45984 (MAPK9)
T141 Phosphorylation
T143 Phosphorylation
T145 Phosphorylation
S149 Phosphorylation
T154 Phosphorylation P45984 (MAPK9)
T156 Phosphorylation
S163 Phosphorylation
S164 Phosphorylation Q15208 (STK38)
K181 Ubiquitination
Y188 Phosphorylation
S217 Phosphorylation
T241 O-Glycosylation
K254 Ubiquitination
S274 Phosphorylation
S276 Phosphorylation
K280 Sumoylation
K280 Ubiquitination
S289 Phosphorylation P06493 (CDK1)
S300 Phosphorylation
K315 Acetylation
K315 Ubiquitination
K321 Ubiquitination
S340 Phosphorylation
K342 Ubiquitination
T354 Phosphorylation
T361 Phosphorylation
S366 Phosphorylation
S367 Phosphorylation P45984 (MAPK9) , P06493 (CDK1)
S371 Phosphorylation
S381 Phosphorylation
S382 Phosphorylation
S388 Phosphorylation
T390 Phosphorylation
Y391 Phosphorylation
S397 Phosphorylation O95835 (LATS1) , Q9NRM7 (LATS2)
T398 Phosphorylation
S400 Phosphorylation P48730 (CSNK1D) , P49674 (CSNK1E)
S403 Phosphorylation P48730 (CSNK1D) , P49674 (CSNK1E)
S405 Phosphorylation
Y407 Phosphorylation P00519 (ABL1)
T412 Phosphorylation
S419 Phosphorylation
S473 Phosphorylation
K494 Methylation
K497 Methylation
K497 Ubiquitination
S499 Phosphorylation
IMPORTANT: For western blots, incubate membrane with diluted antibody in 5% w/v milk , 1X TBS, 0.1% Tween®20 at 4°C with gentle shaking, overnight.

To Top