Phospho-Claudin 4 (Tyr208) Antibody - #AF8257

(5)  
Product: Phospho-Claudin 4 (Tyr208) Antibody
Catalog: AF8257
Description: Rabbit polyclonal antibody to Phospho-Claudin 4 (Tyr208)
Application: WB IHC
Reactivity: Human, Mouse, Rat, Monkey
Mol.Wt.: 22 kDa; 22kD(Calculated).
Uniprot: O14493
RRID: AB_2840319

View similar products>>

   Size Price Inventory
 100ul $350 In stock
 200ul $450 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MS Report
HPLC Report
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:1000-3000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat,Monkey
Clonality:
Polyclonal
Specificity:
Phospho-Claudin 4 (Tyr208) Antibody detects endogenous levels of Claudin 4 only when phosphorylated at Tyr208.
RRID:
AB_2840319
Cite Format: Affinity Biosciences Cat# AF8257, RRID:AB_2840319.
Conjugate:
Unconjugated.
Purification:
The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Claudin-4; Claudin4; CLD4_HUMAN; CLDN 4; CLDN4; Clostridium perfringens enterotoxin receptor 1; Clostridium perfringens enterotoxin receptor; CPE R; CPE receptor; CPE-R; CPE-receptor; CPER; CPETR 1; CPETR; CPETR1; hCPE R; WBSCR8; Williams Beuren syndrome chromosome region 8 protein; Williams-Beuren syndrome chromosomal region 8 protein;

Immunogens

Immunogen:
Uniprot:

O14493(CLD4_HUMAN) >>Visit HPA database.

Gene(ID):
CLDN4(1364)
Sequence:
MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV

PTMs - O14493 As Substrate

Site PTM Type Enzyme
T189 Phosphorylation
Y193 Phosphorylation
S194 Phosphorylation P17252 (PRKCA)
Y197 Phosphorylation
S198 Phosphorylation
S202 Phosphorylation
S206 Phosphorylation
Y208 Phosphorylation P29317 (EPHA2)

Research Backgrounds

Function:

Channel-forming tight junction protein that mediates paracellular chloride transport in the kidney. Plays a critical role in the paracellular reabsorption of filtered chloride in the kidney collecting ducts. Claudins play a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.

PTMs:

Phosphorylated. Phosphorylation by EPHA2 is stimulated by EFNA1 and alters interaction with TJP1.

Subcellular Location:

Cell junction>Tight junction. Cell membrane>Multi-pass membrane protein.
Note: CLDN4 is required for tight junction localization in the kidney.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Directly interacts with TJP1/ZO-1. Interacts with TJP2/ZO-2 and TJP3/ZO-3 (By similarity). Interacts with EPHA2; phosphorylates CLDN4 and may regulate tight junctions. Interacts with CLDN1. Interacts with CLDN8 (By similarity).

(Microbial infection) Interacts (via both extracellular domains) with Clostridium perfringens enterotoxin CPE; the interaction may disrupt claudin assembly in tight junctions.

Family&Domains:

Belongs to the claudin family.

Research Fields

· Cellular Processes > Cellular community - eukaryotes > Tight junction.   (View pathway)

· Environmental Information Processing > Signaling molecules and interaction > Cell adhesion molecules (CAMs).   (View pathway)

· Human Diseases > Infectious diseases: Viral > Hepatitis C.

· Organismal Systems > Immune system > Leukocyte transendothelial migration.   (View pathway)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.