STEAP4 Antibody - #AF0574
Product: | STEAP4 Antibody |
Catalog: | AF0574 |
Description: | Rabbit polyclonal antibody to STEAP4 |
Application: | WB IHC IF/ICC |
Reactivity: | Human |
Prediction: | Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
Mol.Wt.: | 51kDa; 52kD(Calculated). |
Uniprot: | Q687X5 |
RRID: | AB_2834285 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF0574, RRID:AB_2834285.
Fold/Unfold
alpha-induced protein 9; Metalloreductase STEAP4; six transmembrane prostate protein 2; Six-transmembrane epithelial antigen of prostate 4; SixTransMembrane protein of prostate 2; STAMP 2; STAMP2; STEA4_HUMAN; STEAP 4; STEAP family member 4; STEAP4; TIARP; TNFAIP 9; TNFAIP9; Tumor necrosis factor; tumor necrosis factor, alpha-induced protein 9; tumor necrosis-alpha-induced adipose-related protein;
Immunogens
Ubiquitous. Highly expressed in adipose tissue. Expressed in placenta, lung, heart and prostate. Detected at lower levels in liver, skeletal muscle, pancreas, testis and small intestine. Highly expressed in joints of patients with rheumatoid arthritis and localized with CD68 cells, a marker for macrophages.
- Q687X5 STEA4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEKTCIDALPLTMNSSEKQETVCIFGTGDFGRSLGLKMLQCGYSVVFGSRNPQKTTLLPSGAEVLSYSEAAKKSGIIIIAIHREHYDFLTELTEVLNGKILVDISNNLKINQYPESNAEYLAHLVPGAHVVKAFNTISAWALQSGALDASRQVFVCGNDSKAKQRVMDIVRNLGLTPMDQGSLMAAKEIEKYPLQLFPMWRFPFYLSAVLCVFLFFYCVIRDVIYPYVYEKKDNTFRMAISIPNRIFPITALTLLALVYLPGVIAAILQLYRGTKYRRFPDWLDHWMLCRKQLGLVALGFAFLHVLYTLVIPIRYYVRWRLGNLTVTQAILKKENPFSTSSAWLSDSYVALGILGFFLFVLLGITSLPSVSNAVNWREFRFVQSKLGYLTLILCTAHTLVYGGKRFLSPSNLRWYLPAAYVLGLIIPCTVLVIKFVLIMPCVDNTLTRIRQGWERNSKH
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q687X5 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K3 | Ubiquitination | Uniprot | |
K18 | Ubiquitination | Uniprot | |
S33 | Phosphorylation | Uniprot | |
K54 | Ubiquitination | Uniprot | |
S60 | Phosphorylation | Uniprot | |
K72 | Ubiquitination | Uniprot | |
K109 | Ubiquitination | Uniprot | |
K161 | Ubiquitination | Uniprot | |
T176 | Phosphorylation | Uniprot | |
S182 | Phosphorylation | Uniprot | |
K187 | Ubiquitination | Uniprot | |
Y225 | Phosphorylation | Uniprot | |
N323 | N-Glycosylation | Uniprot | |
S408 | Phosphorylation | Uniprot |
Research Backgrounds
Integral membrane protein that functions as NADPH-dependent ferric-chelate reductase, using NADPH from one side of the membrane to reduce a Fe(3+) chelate that is bound on the other side of the membrane. Mediates sequential transmembrane electron transfer from NADPH to FAD and onto heme, and finally to the Fe(3+) chelate. Can also reduce Cu(2+) to Cu(1+) (By similarity). Plays a role in systemic metabolic homeostasis, integrating inflammatory and metabolic responses (By similarity). Associated with obesity and insulin-resistance. Involved in inflammatory arthritis, through the regulation of inflammatory cytokines. Inhibits anchorage-independent cell proliferation.
Cell membrane>Multi-pass membrane protein. Golgi apparatus membrane>Multi-pass membrane protein. Early endosome membrane>Multi-pass membrane protein.
Ubiquitous. Highly expressed in adipose tissue. Expressed in placenta, lung, heart and prostate. Detected at lower levels in liver, skeletal muscle, pancreas, testis and small intestine. Highly expressed in joints of patients with rheumatoid arthritis and localized with CD68 cells, a marker for macrophages.
Homotrimer. Interacts with PTK2/FAK1; the interaction may regulate PTK2 phosphorylation.
Belongs to the STEAP family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.