PHLA2 Antibody - #AF0668
Product: | PHLA2 Antibody |
Catalog: | AF0668 |
Description: | Rabbit polyclonal antibody to PHLA2 |
Application: | WB IHC |
Reactivity: | Human |
Prediction: | Pig, Bovine, Chicken |
Mol.Wt.: | 17kDa; 17kD(Calculated). |
Uniprot: | Q53GA4 |
RRID: | AB_2834276 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF0668, RRID:AB_2834276.
Fold/Unfold
Beckwith Wiedemann syndrome chromosome region 1 candidate protein C; Beckwith-Wiedemann syndrome chromosomal region 1 candidate gene C protein; BRW 1C; BRW1C; BWR 1C; BWR1C; HLDA 2; HLDA2; Imprinted in placenta and liver; Imprinted in placenta and liver protein; IPL; p17 Beckwith Wiedemann region 1C; p17 BWR1C; p17-Beckwith-Wiedemann region 1 C; p17-BWR1C; PHLA2_HUMAN; PHLDA 2; phlda2; Pleckstrin homology like domain family A member 2; Pleckstrin homology-like domain family A member 2; TSSC 3; Tumor suppressing STF cDNA 3 protein; Tumor suppressing subchromosomal transferable fragment candidate gene 3 protein; Tumor suppressing subchromosomal transferable fragment cDNA 3; Tumor suppressing subtransferable candidate 3; Tumor supressing STF cDNA 3; Tumor-suppressing STF cDNA 3 protein; Tumor-suppressing subchromosomal transferable fragment candidate gene 3 protein;
Immunogens
Expressed in placenta and adult prostate gland. In placenta, it is present in all cells of the villous cytotrophoblast. The protein is absent in cells from hydatidiform moles. Hydatidiform mole is a gestation characterized by abnormal development of both fetus and trophoblast. The majority of hydatidiform moles are associated with an excess of paternal to maternal genomes and are likely to result from the abnormal expression of imprinted genes (at protein level). Expressed at low levels in adult liver and lung, and fetal liver. Expressed in adult brain and neuroblastoma, medullablastoma and glioblastoma cell lines.
- Q53GA4 PHLA2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKSPDEVLREGELEKRSDSLFQLWKKKRGVLTSDRLSLFPASPRARPKELRFHSILKVDCVERTGKYVYFTIVTTDHKEIDFRCAGESCWNAAIALALIDFQNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEPSRPSPQPKPRTP
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q53GA4 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K2 | Ubiquitination | Uniprot | |
S3 | Phosphorylation | Uniprot | |
K15 | Ubiquitination | Uniprot | |
K25 | Ubiquitination | Uniprot | |
T32 | Phosphorylation | Uniprot | |
S42 | Phosphorylation | Uniprot | |
K57 | Ubiquitination | Uniprot | |
K66 | Ubiquitination | Uniprot | |
S138 | Phosphorylation | Uniprot | |
S141 | Phosphorylation | Uniprot | |
S144 | Phosphorylation | Uniprot | |
T151 | Phosphorylation | Uniprot |
Research Backgrounds
Plays a role in regulating placenta growth. May act via its PH domain that competes with other PH domain-containing proteins, thereby preventing their binding to membrane lipids (By similarity).
Cytoplasm. Membrane>Peripheral membrane protein.
Expressed in placenta and adult prostate gland. In placenta, it is present in all cells of the villous cytotrophoblast. The protein is absent in cells from hydatidiform moles. Hydatidiform mole is a gestation characterized by abnormal development of both fetus and trophoblast. The majority of hydatidiform moles are associated with an excess of paternal to maternal genomes and are likely to result from the abnormal expression of imprinted genes (at protein level). Expressed at low levels in adult liver and lung, and fetal liver. Expressed in adult brain and neuroblastoma, medullablastoma and glioblastoma cell lines.
The PH domain binds phosphoinositides with a broad specificity. It may compete with the PH domain of some other proteins, thereby interfering with their binding to phosphatidylinositol 4,5-bisphosphate (PIP2) and phosphatidylinositol 3,4,5-trisphosphate (PIP3) (By similarity).
Belongs to the PHLDA2 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.